PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_9BF07972C.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 346aa    MW: 36794.5 Da    PI: 6.3927
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_9BF07972C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-181562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd+llvd++++ G g+W++ ++  g++R++k+c++rw +yl
  Traes_4AL_9BF07972C.2 15 KGPWTPEEDKLLVDYIQEKGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                           79********************************************97 PP

2Myb_DNA-binding582.1e-1868113148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rgr+T++E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
  Traes_4AL_9BF07972C.2  68 RGRFTEDEEKLIIHLHSLLGNK-WSSIATKLP-GRTDNEIKNYWNTHL 113
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0971062IPR017930Myb domain
SuperFamilySSF466899.54E-3112109IPR009057Homeodomain-like
SMARTSM007171.1E-141464IPR001005SANT/Myb domain
PfamPF002498.2E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231669IPR009057Homeodomain-like
CDDcd001679.87E-121762No hitNo description
PROSITE profilePS5129428.08663117IPR017930Myb domain
SMARTSM007175.7E-1767115IPR001005SANT/Myb domain
PfamPF002496.8E-1768113IPR001005SANT/Myb domain
CDDcd001673.37E-1370113No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRSPCCDGE AGVKKGPWTP EEDKLLVDYI QEKGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGR FTEDEEKLII HLHSLLGNKW SSIATKLPGR TDNEIKNYWN THLRKKLLGM  120
GIDPVTHRPR TDLSLLAGLP GLLAAAGNFG GAGSATGAWD MNALRLQADA AKFQLLQGLV  180
RALTTAAVPA LAPGMDNLMA LLAASNGGQN GAGGVDQSML LQQCQWDGMN NLPALTNSAP  240
ASGMHNISGM FDSFGAGDGL SSTELGCHGG ASGSNVTVDA VAPPRPMVAN DRDCNNNGGG  300
GVSCEQTPAS SPFDGLESLN LMDDLNTDGS WKDLLDQMSW LNSSEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-30151174105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-30151174105C-Myb DNA-Binding Domain
1msf_C6e-30151174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-149KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964317.11e-147PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-81MYB39_ARATH; Transcription factor MYB39
TrEMBLW5DRS60.0W5DRS6_WHEAT; Uncharacterized protein
STRINGSi006790m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.27e-79myb domain protein 9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]